Recombinant Full Length Human Dolichyl-Diphosphooligosaccharide--Protein Glycosyltransferase 48 Kda Subunit(Ddost) Protein, His-Tagged
| Cat.No. : | RFL15341HF |
| Product Overview : | Recombinant Full Length Human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(DDOST) Protein (P39656) (43-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (43-456) |
| Form : | Lyophilized powder |
| AA Sequence : | SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | DDOST |
| Synonyms | DDOST; KIAA0115; OST48; OK/SW-cl.45; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; DDOST 48 kDa subunit; Oligosaccharyl transferase 48 kDa subunit |
| UniProt ID | P39656 |
| ◆ Recombinant Proteins | ||
| DDOST-1472R | Recombinant Rat DDOST Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ddost-2495M | Recombinant Mouse Ddost Protein, Myc/DDK-tagged | +Inquiry |
| RFL10395GF | Recombinant Full Length Chicken Dolichyl-Diphosphooligosaccharide--Protein Glycosyltransferase 48 Kda Subunit(Ddost) Protein, His-Tagged | +Inquiry |
| DDOST-1937H | Recombinant Human DDOST Protein (Ser43-Pro427), N-His tagged | +Inquiry |
| DDOST-11884H | Recombinant Human DDOST, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDOST-7024HCL | Recombinant Human DDOST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDOST Products
Required fields are marked with *
My Review for All DDOST Products
Required fields are marked with *
