Recombinant Full Length Human ERCC8 Protein
Cat.No. : | ERCC8-160HF |
Product Overview : | Recombinant full length Human ERCC8 with N terminal proprietary tag, 69.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 396 amino acids |
Description : | This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. |
Form : | Liquid |
Molecular Mass : | 69.560kDa inclusive of tags |
AA Sequence : | MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVER IHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQS YYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVA VGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRYDY ILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENT LVNYGKVCNNSKKGLKFTVSCGCSSEFVFVPYGSTIAVYT VYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | ERCC8 excision repair cross-complementing rodent repair deficiency, complementation group 8 [ Homo sapiens ] |
Official Symbol | ERCC8 |
Synonyms | ERCC8; excision repair cross-complementing rodent repair deficiency, complementation group 8; CKN1, Cockayne syndrome 1 (classical); DNA excision repair protein ERCC-8; CSA |
Gene ID | 1161 |
mRNA Refseq | NM_000082 |
Protein Refseq | NP_000073 |
MIM | 609412 |
UniProt ID | Q13216 |
◆ Recombinant Proteins | ||
ERCC8-26850TH | Recombinant Human ERCC8 | +Inquiry |
ERCC8-12527H | Recombinant Human ERCC8 protein, His-tagged | +Inquiry |
ERCC8-3463H | Recombinant Human ERCC8 Protein, GST-tagged | +Inquiry |
ERCC8-160HF | Recombinant Full Length Human ERCC8 Protein | +Inquiry |
ERCC8-2845M | Recombinant Mouse ERCC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC8-6562HCL | Recombinant Human ERCC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERCC8 Products
Required fields are marked with *
My Review for All ERCC8 Products
Required fields are marked with *