Recombinant Full Length Human Frizzled-4(Fzd4) Protein, His-Tagged
Cat.No. : | RFL27403HF |
Product Overview : | Recombinant Full Length Human Frizzled-4(FZD4) Protein (Q9ULV1) (37-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (37-537) |
Form : | Lyophilized powder |
AA Sequence : | FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQF FLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNH MCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAK EFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVG RERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWG HEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLF TYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF YEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGK VKREKRGNGWVKPGKGSETVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FZD4 |
Synonyms | FZD4; Frizzled-4; Fz-4; hFz4; FzE4; CD antigen CD344 |
UniProt ID | Q9ULV1 |
◆ Recombinant Proteins | ||
RFL26741RF | Recombinant Full Length Rat Frizzled-4(Fzd4) Protein, His-Tagged | +Inquiry |
FZD4-1765R | Recombinant Rhesus Monkey FZD4 Protein, hIgG1-tagged | +Inquiry |
RFL25517MF | Recombinant Full Length Mouse Frizzled-4(Fzd4) Protein, His-Tagged | +Inquiry |
FZD4-4592H | Recombinant Human FZD4 Protein | +Inquiry |
FZD4-5200H | Recombinant Human FZD4 Protein (Met1-Glu180), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD4-1196RCL | Recombinant Rat FZD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD4 Products
Required fields are marked with *
My Review for All FZD4 Products
Required fields are marked with *
0
Inquiry Basket