Recombinant Full Length Human HBQ1 Protein, GST-tagged
Cat.No. : | HBQ1-3499HF |
Product Overview : | Human HBQ1 full-length ORF (AAH56686.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 142 amino acids |
Description : | Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5 - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. [provided by RefSeq |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HBQ1 hemoglobin, theta 1 [ Homo sapiens ] |
Official Symbol | HBQ1 |
Synonyms | hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain; |
Gene ID | 3049 |
mRNA Refseq | NM_005331 |
Protein Refseq | NP_005322 |
MIM | 142240 |
UniProt ID | P09105 |
◆ Recombinant Proteins | ||
HBQ1-4607H | Recombinant Human HBQ1 Protein, GST-tagged | +Inquiry |
HBQ1-15874H | Recombinant Human HBQ1, His-tagged | +Inquiry |
HBQ1-1061H | Recombinant Human HBQ1 Protein, MYC/DDK-tagged | +Inquiry |
HBQ1-6874H | Recombinant Human HBQ1 protein, GST-tagged | +Inquiry |
HBQ1-13686H | Recombinant Human HBQ1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBQ1-317HCL | Recombinant Human HBQ1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBQ1 Products
Required fields are marked with *
My Review for All HBQ1 Products
Required fields are marked with *