Recombinant Human HBQ1 protein, His-tagged

Cat.No. : HBQ1-13686H
Product Overview : Recombinant Human HBQ1 protein(1-142 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-142 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol HBQ1
Synonyms hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain;
Gene ID 3049
mRNA Refseq NM_005331.4
Protein Refseq NP_005322.1
MIM 142240
UniProt ID P09105

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HBQ1 Products

Required fields are marked with *

My Review for All HBQ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon