Recombinant Human HBQ1 protein, GST-tagged
Cat.No. : | HBQ1-6874H |
Product Overview : | Recombinant Human HBQ1 protein(1-142 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-142 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | HBQ1 |
Synonyms | hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain; |
Gene ID | 3049 |
mRNA Refseq | NM_005331.4 |
Protein Refseq | NP_005322.1 |
MIM | 142240 |
UniProt ID | P09105 |
◆ Recombinant Proteins | ||
HBQ1-3499HF | Recombinant Full Length Human HBQ1 Protein, GST-tagged | +Inquiry |
HBQ1-4607H | Recombinant Human HBQ1 Protein, GST-tagged | +Inquiry |
HBQ1-450H | Recombinant Human HBQ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HBQ1-13686H | Recombinant Human HBQ1 protein, His-tagged | +Inquiry |
HBQ1-1061H | Recombinant Human HBQ1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBQ1-317HCL | Recombinant Human HBQ1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBQ1 Products
Required fields are marked with *
My Review for All HBQ1 Products
Required fields are marked with *