Recombinant Human HBQ1 Protein, GST-tagged

Cat.No. : HBQ1-4607H
Product Overview : Human HBQ1 full-length ORF (AAH56686.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5 - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. [provided by RefSeq
Molecular Mass : 42.02 kDa
AA Sequence : MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBQ1 hemoglobin, theta 1 [ Homo sapiens ]
Official Symbol HBQ1
Synonyms hemoglobin, theta 1; 4833; Ensembl:ENSG00000086506; hemoglobin subunit theta-1;theta-1-globin;hemoglobin theta-1 chain;
Gene ID 3049
mRNA Refseq NM_005331
Protein Refseq NP_005322
MIM 142240
UniProt ID P09105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBQ1 Products

Required fields are marked with *

My Review for All HBQ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon