Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged
Cat.No. : | RFL21480HF |
Product Overview : | Recombinant Full Length Human HLA class II histocompatibility antigen gamma chain(CD74) Protein (P04233) (1-296aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-296) |
Form : | Lyophilized powder |
AA Sequence : | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD74 |
Synonyms | CD74; DHLAG; HLA class II histocompatibility antigen gamma chain; HLA-DR antigens-associated invariant chain; Ia antigen-associated invariant chain; Ii; CD antigen CD74 |
UniProt ID | P04233 |
◆ Recombinant Proteins | ||
CD74-698H | Recombinant Human CD74 Protein, His-tagged | +Inquiry |
CD74-920R | Recombinant Rat CD74 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd74-1157M | Recombinant Mouse Cd74 Protein, His-tagged | +Inquiry |
CD74-1262R | Recombinant Rat CD74 Protein | +Inquiry |
CD74-2231H | Active Recombinant Human CD74, Hemagglutinin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD74 Products
Required fields are marked with *
My Review for All CD74 Products
Required fields are marked with *