Recombinant Full Length Human HMCES Protein, GST-tagged

Cat.No. : HMCES-2594HF
Product Overview : Human HMCES full-length ORF (NP_001006109.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 354 amino acids
Description : HMCES (5-Hydroxymethylcytosine Binding, ES Cell Specific) is a Protein Coding gene. GO annotations related to this gene include peptidase activity.
Molecular Mass : 67 kDa
AA Sequence : MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMCES 5-hydroxymethylcytosine (hmC) binding, ES cell-specific [ Homo sapiens (human) ]
Official Symbol HMCES
Synonyms HMCES; 5-hydroxymethylcytosine (hmC) binding, ES cell-specific; C3ORF37; chromosome 3 open reading frame 37; UPF0361 protein C3orf37; DC12; MGC111075; SRAPD1; 5-Hydroxymethylcytosine Binding, ES Cell Specific; Embryonic Stem Cell-Specific 5-Hydroxymethylcytosine-Binding Protein; 5-Hydroxymethylcytosine (HmC) Binding, ES Cell-Specific; ES Cell-Specific 5hmC-Binding Protein; SRAP Domain-Containing Protein 1; Putative Peptidase SRAPD1; SOS Response Associated Peptidase Domain Containing 1; Chromosome 3 Open Reading Frame 37; UPF0361 Protein C3orf37; EC 3.4.-.-
Gene ID 56941
mRNA Refseq NM_001006109
Protein Refseq NP_001006109
MIM 618288
UniProt ID Q96FZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMCES Products

Required fields are marked with *

My Review for All HMCES Products

Required fields are marked with *

0
cart-icon
0
compare icon