Recombinant Full Length Human HMCES Protein, GST-tagged
| Cat.No. : | HMCES-2594HF |
| Product Overview : | Human HMCES full-length ORF (NP_001006109.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 354 amino acids |
| Description : | HMCES (5-Hydroxymethylcytosine Binding, ES Cell Specific) is a Protein Coding gene. GO annotations related to this gene include peptidase activity. |
| Molecular Mass : | 67 kDa |
| AA Sequence : | MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HMCES 5-hydroxymethylcytosine (hmC) binding, ES cell-specific [ Homo sapiens (human) ] |
| Official Symbol | HMCES |
| Synonyms | HMCES; 5-hydroxymethylcytosine (hmC) binding, ES cell-specific; C3ORF37; chromosome 3 open reading frame 37; UPF0361 protein C3orf37; DC12; MGC111075; SRAPD1; 5-Hydroxymethylcytosine Binding, ES Cell Specific; Embryonic Stem Cell-Specific 5-Hydroxymethylcytosine-Binding Protein; 5-Hydroxymethylcytosine (HmC) Binding, ES Cell-Specific; ES Cell-Specific 5hmC-Binding Protein; SRAP Domain-Containing Protein 1; Putative Peptidase SRAPD1; SOS Response Associated Peptidase Domain Containing 1; Chromosome 3 Open Reading Frame 37; UPF0361 Protein C3orf37; EC 3.4.-.- |
| Gene ID | 56941 |
| mRNA Refseq | NM_001006109 |
| Protein Refseq | NP_001006109 |
| MIM | 618288 |
| UniProt ID | Q96FZ2 |
| ◆ Recombinant Proteins | ||
| HMCES-2613H | Recombinant Human HMCES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMCES-0030H | Recombinant Human HMCES Protein, GST-Tagged | +Inquiry |
| HMCES-2594HF | Recombinant Full Length Human HMCES Protein, GST-tagged | +Inquiry |
| HMCES-5764Z | Recombinant Zebrafish HMCES | +Inquiry |
| HMCES-4955H | Recombinant Human HMCES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMCES Products
Required fields are marked with *
My Review for All HMCES Products
Required fields are marked with *



