Recombinant Full Length Human HMGCS2 Protein, C-Flag-tagged
Cat.No. : | HMGCS2-1766HFL |
Product Overview : | Recombinant Full Length Human HMGCS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.3 kDa |
AA Sequence : | MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQ TDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKA VKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGG AGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQ WKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNK DLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTW YLERVDEQHRRKYARRPV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Butanoate metabolism, Metabolic pathways, PPAR signaling pathway, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | HMGCS2 3-hydroxy-3-methylglutaryl-CoA synthase 2 [ Homo sapiens (human) ] |
Official Symbol | HMGCS2 |
Synonyms | 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial); hydroxymethylglutaryl-CoA synthase 2; OTTHUMP00000013928 |
Gene ID | 3158 |
mRNA Refseq | NM_005518.4 |
Protein Refseq | NP_005509.1 |
MIM | 600234 |
UniProt ID | P54868 |
◆ Recombinant Proteins | ||
HMGCS2-4242M | Recombinant Mouse HMGCS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCS2-3649HF | Recombinant Full Length Human HMGCS2 Protein, GST-tagged | +Inquiry |
Hmgcs2-1137M | Recombinant Mouse Hmgcs2 Protein, MYC/DDK-tagged | +Inquiry |
HMGCS2-1766HFL | Recombinant Full Length Human HMGCS2 Protein, C-Flag-tagged | +Inquiry |
HMGCS2-134H | Recombinant Human HMGCS2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCS2-804HCL | Recombinant Human HMGCS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGCS2 Products
Required fields are marked with *
My Review for All HMGCS2 Products
Required fields are marked with *
0
Inquiry Basket