Recombinant Full Length Human Myelin Protein P0(Mpz) Protein, His-Tagged
| Cat.No. : | RFL16682HF |
| Product Overview : | Recombinant Full Length Human Myelin protein P0(MPZ) Protein (P25189) (30-248aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (30-248) |
| Form : | Lyophilized powder |
| AA Sequence : | IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MPZ |
| Synonyms | Charcot Marie Tooth neuropathy 1B; CHM; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; DSS; HMSNIB; MPP; MPZ; Myelin peripheral protein; Myelin protein P0; Myelin protein zero; MYP0_HUMAN; P0 |
| UniProt ID | P25189 |
| ◆ Recombinant Proteins | ||
| MPZ-1218H | Recombinant Human MPZ Protein (30-156 aa), GST-tagged | +Inquiry |
| MPZ-1461H | Recombinant Human MPZ Protein (30-156 aa), His-tagged | +Inquiry |
| MPZ-6337HF | Recombinant Full Length Human MPZ Protein, GST-tagged | +Inquiry |
| RFL31068BF | Recombinant Full Length Bovine Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| MPZ-3744R | Recombinant Rat MPZ Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *




