Recombinant Full Length Human NR2C2 Protein, C-Flag-tagged
Cat.No. : | NR2C2-1900HFL |
Product Overview : | Recombinant Full Length Human NR2C2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.2 kDa |
AA Sequence : | MTSPSPRIQIISTDSAVASPQRIQGSEPASGPLSVFTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQF ILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCG DKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSER KPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLL ATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSL ADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWA RSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEH IWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLA RILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Full Length : | Full L. |
Gene Name | NR2C2 nuclear receptor subfamily 2 group C member 2 [ Homo sapiens (human) ] |
Official Symbol | NR2C2 |
Synonyms | TR4; TAK1 |
Gene ID | 7182 |
mRNA Refseq | NM_003298.5 |
Protein Refseq | NP_003289.2 |
MIM | 601426 |
UniProt ID | P49116 |
◆ Recombinant Proteins | ||
NR2C2-6079H | Recombinant Human NR2C2 Protein, GST-tagged | +Inquiry |
Nr2c2-4488M | Recombinant Mouse Nr2c2 Protein, Myc/DDK-tagged | +Inquiry |
NR2C2-10862M | Recombinant Mouse NR2C2 Protein | +Inquiry |
NR2C2-3725R | Recombinant Rat NR2C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2C2-4066R | Recombinant Rat NR2C2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2C2-3713HCL | Recombinant Human NR2C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2C2 Products
Required fields are marked with *
My Review for All NR2C2 Products
Required fields are marked with *
0
Inquiry Basket