Recombinant Full Length Human NR4A1 Protein, C-Flag-tagged
Cat.No. : | NR4A1-61HFL |
Product Overview : | Recombinant Full Length Human NR4A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.3 kDa |
AA Sequence : | MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQ LPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPS PSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLF PSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG VRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFS RSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLP ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | NR4A1 nuclear receptor subfamily 4 group A member 1 [ Homo sapiens (human) ] |
Official Symbol | NR4A1 |
Synonyms | HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77 |
Gene ID | 3164 |
mRNA Refseq | NM_002135.5 |
Protein Refseq | NP_002126.2 |
MIM | 139139 |
UniProt ID | P22736 |
◆ Recombinant Proteins | ||
NR4A1-1360H | Recombinant Human NR4A1, GST-tagged | +Inquiry |
NR4A1-3729R | Recombinant Rat NR4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR4A1-6093H | Recombinant Human NR4A1 Protein, GST-tagged | +Inquiry |
NR4A1-30494TH | Recombinant Human NR4A1 | +Inquiry |
NR4A1-12H | Recombinant Human NR4A1 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A1-1219HCL | Recombinant Human NR4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR4A1 Products
Required fields are marked with *
My Review for All NR4A1 Products
Required fields are marked with *
0
Inquiry Basket