Recombinant Full Length Human OTULIN Protein, GST-tagged

Cat.No. : OTULIN-4460HF
Product Overview : Human FAM105B full-length ORF ( AAH07706.3, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 214 amino acids
Description : This gene encodes a member of the peptidase C65 family of ubiquitin isopeptidases. Members of this family remove ubiquitin from proteins. The encoded enzyme specifically recognizes and removes M1(Met1)-linked, or linear, ubiquitin chains from protein substrates. Linear ubiquitin chains are known to regulate the NF-kappa B signaling pathway in the context of immunity and inflammation. Mutations in this gene cause a potentially fatal autoinflammatory syndrome in human patients. [provided by RefSeq, Sep 2016]
Molecular Mass : 51.3 kDa
AA Sequence : MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name OTULIN OTU deubiquitinase with linear linkage specificity [ Homo sapiens (human) ]
Official Symbol OTULIN
Synonyms OTULIN; OTU deubiquitinase with linear linkage specificity; OTU Deubiquitinase With Linear Linkage Specificity; OTU Domain-Containing Deubiquitinase With Linear Linkage Specificity; Family With Sequence Similarity 105, Member B; Deubiquitinating Enzyme Otulin; Ubiquitin Thioesterase Gumby; FAM105B; Ubiquitin Thioesterase Otulin; EC 3.4.19.12; Gumby; AIPDS; GUM; ubiquitin thioesterase otulin; OTU domain-containing deubiquitinase with linear linkage specificity; deubiquitinating enzyme otulin; family with sequence similarity 105, member B; ubiquitin thioesterase Gumby
Gene ID 90268
mRNA Refseq NM_138348
Protein Refseq NP_612357
MIM 615712
UniProt ID Q96BN8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OTULIN Products

Required fields are marked with *

My Review for All OTULIN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon