Recombinant Full Length Human OTULIN Protein, GST-tagged
Cat.No. : | OTULIN-4460HF |
Product Overview : | Human FAM105B full-length ORF ( AAH07706.3, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 214 amino acids |
Description : | This gene encodes a member of the peptidase C65 family of ubiquitin isopeptidases. Members of this family remove ubiquitin from proteins. The encoded enzyme specifically recognizes and removes M1(Met1)-linked, or linear, ubiquitin chains from protein substrates. Linear ubiquitin chains are known to regulate the NF-kappa B signaling pathway in the context of immunity and inflammation. Mutations in this gene cause a potentially fatal autoinflammatory syndrome in human patients. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | OTULIN OTU deubiquitinase with linear linkage specificity [ Homo sapiens (human) ] |
Official Symbol | OTULIN |
Synonyms | OTULIN; OTU deubiquitinase with linear linkage specificity; OTU Deubiquitinase With Linear Linkage Specificity; OTU Domain-Containing Deubiquitinase With Linear Linkage Specificity; Family With Sequence Similarity 105, Member B; Deubiquitinating Enzyme Otulin; Ubiquitin Thioesterase Gumby; FAM105B; Ubiquitin Thioesterase Otulin; EC 3.4.19.12; Gumby; AIPDS; GUM; ubiquitin thioesterase otulin; OTU domain-containing deubiquitinase with linear linkage specificity; deubiquitinating enzyme otulin; family with sequence similarity 105, member B; ubiquitin thioesterase Gumby |
Gene ID | 90268 |
mRNA Refseq | NM_138348 |
Protein Refseq | NP_612357 |
MIM | 615712 |
UniProt ID | Q96BN8 |
◆ Recombinant Proteins | ||
OTULIN-4460HF | Recombinant Full Length Human OTULIN Protein, GST-tagged | +Inquiry |
OTULIN-357H | Recombinant Human OTULIN Protein, His-tagged | +Inquiry |
OTULIN-157H | Active Recombinant Human OTULIN, GST-tagged | +Inquiry |
OTULIN-2512H | Recombinant Human OTULIN protein, His-tagged | +Inquiry |
OTULIN-3666H | Recombinant Human OTULIN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTULIN Products
Required fields are marked with *
My Review for All OTULIN Products
Required fields are marked with *
0
Inquiry Basket