Recombinant Full Length Human OTULIN Protein, GST-tagged
| Cat.No. : | OTULIN-4460HF |
| Product Overview : | Human FAM105B full-length ORF ( AAH07706.3, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 214 amino acids |
| Description : | This gene encodes a member of the peptidase C65 family of ubiquitin isopeptidases. Members of this family remove ubiquitin from proteins. The encoded enzyme specifically recognizes and removes M1(Met1)-linked, or linear, ubiquitin chains from protein substrates. Linear ubiquitin chains are known to regulate the NF-kappa B signaling pathway in the context of immunity and inflammation. Mutations in this gene cause a potentially fatal autoinflammatory syndrome in human patients. [provided by RefSeq, Sep 2016] |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | OTULIN OTU deubiquitinase with linear linkage specificity [ Homo sapiens (human) ] |
| Official Symbol | OTULIN |
| Synonyms | OTULIN; OTU deubiquitinase with linear linkage specificity; OTU Deubiquitinase With Linear Linkage Specificity; OTU Domain-Containing Deubiquitinase With Linear Linkage Specificity; Family With Sequence Similarity 105, Member B; Deubiquitinating Enzyme Otulin; Ubiquitin Thioesterase Gumby; FAM105B; Ubiquitin Thioesterase Otulin; EC 3.4.19.12; Gumby; AIPDS; GUM; ubiquitin thioesterase otulin; OTU domain-containing deubiquitinase with linear linkage specificity; deubiquitinating enzyme otulin; family with sequence similarity 105, member B; ubiquitin thioesterase Gumby |
| Gene ID | 90268 |
| mRNA Refseq | NM_138348 |
| Protein Refseq | NP_612357 |
| MIM | 615712 |
| UniProt ID | Q96BN8 |
| ◆ Recombinant Proteins | ||
| OTULIN-357H | Recombinant Human OTULIN Protein, His-tagged | +Inquiry |
| OTULIN-157H | Active Recombinant Human OTULIN, GST-tagged | +Inquiry |
| OTULIN-3666H | Recombinant Full Length Human OTULIN Protein, His tagged | +Inquiry |
| OTULIN-4460HF | Recombinant Full Length Human OTULIN Protein, GST-tagged | +Inquiry |
| OTULIN-2512H | Recombinant Human OTULIN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTULIN Products
Required fields are marked with *
My Review for All OTULIN Products
Required fields are marked with *



