Recombinant Human OTULIN protein, His-tagged
Cat.No. : | OTULIN-2512H |
Product Overview : | Recombinant Human OTULIN protein(139-352 aa), fused to His tag, was expressed in E. coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139-352 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | OTULIN OTU deubiquitinase with linear linkage specificity [ Homo sapiens (human) ] |
Official Symbol | OTULIN |
Synonyms | GUM; AIPDS; FAM105B |
Gene ID | 90268 |
mRNA Refseq | NM_138348.6 |
Protein Refseq | NP_612357.4 |
MIM | 615712 |
UniProt ID | Q96BN8 |
◆ Recombinant Proteins | ||
OTULIN-3666H | Recombinant Human OTULIN Protein, GST-tagged | +Inquiry |
OTULIN-357H | Recombinant Human OTULIN Protein, His-tagged | +Inquiry |
OTULIN-157H | Active Recombinant Human OTULIN, GST-tagged | +Inquiry |
OTULIN-4460HF | Recombinant Full Length Human OTULIN Protein, GST-tagged | +Inquiry |
OTULIN-2512H | Recombinant Human OTULIN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTULIN Products
Required fields are marked with *
My Review for All OTULIN Products
Required fields are marked with *
0
Inquiry Basket