Recombinant Full Length Human PRAME Protein, C-Flag-tagged
Cat.No. : | PRAME-252HFL |
Product Overview : | Recombinant Full Length Human PRAME Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MERRRLRGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLK AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNR ASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCC KKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEK EEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHC GDRTFYDPEPILCPCFMPNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PRAME PRAME nuclear receptor transcriptional regulator [ Homo sapiens (human) ] |
Official Symbol | PRAME |
Synonyms | MAPE; OIP4; CT130; OIP-4 |
Gene ID | 23532 |
mRNA Refseq | NM_206955.3 |
Protein Refseq | NP_996838.1 |
MIM | 606021 |
UniProt ID | P78395 |
◆ Recombinant Proteins | ||
PRAME-1474H | Recombinant Human PRAME Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRAME-2874H | Recombinant Human PRAME Protein, His-tagged | +Inquiry |
PRAME-1754H | Recombinant Human PRAME Protein, His (Fc)-Avi-tagged | +Inquiry |
PRAME-723H | Recombinant Human PRAME Protein, His-tagged | +Inquiry |
PRAME-252HFL | Recombinant Full Length Human PRAME Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PRAME-01HB | Recombinant Human PRAME Protein, Tag Free, Biotinylated | +Inquiry |
PRAME-01H | Recombinant Human PRAME Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRAME-2895HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
PRAME-2897HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
PRAME-2896HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRAME Products
Required fields are marked with *
My Review for All PRAME Products
Required fields are marked with *