Recombinant Full Length Human PRDX2 Protein, C-Flag-tagged
Cat.No. : | PRDX2-1239HFL |
Product Overview : | Recombinant Full Length Human PRDX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PRDX2 peroxiredoxin 2 [ Homo sapiens (human) ] |
Official Symbol | PRDX2 |
Synonyms | PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a |
Gene ID | 7001 |
mRNA Refseq | NM_005809.6 |
Protein Refseq | NP_005800.3 |
MIM | 600538 |
UniProt ID | P32119 |
◆ Recombinant Proteins | ||
PRDX2-333H | Recombinant Human PRDX2 Protein, His/GST-tagged | +Inquiry |
PRDX2-1239HFL | Recombinant Full Length Human PRDX2 Protein, C-Flag-tagged | +Inquiry |
PRDX2-3408R | Recombinant Rhesus Macaque PRDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRDX2-870M | Recombinant Mouse PRDX2 Protein (Met1-Asn198), His-tagged | +Inquiry |
PRDX2-4027H | Recombinant Human PRDX2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX2-564HCL | Recombinant Human PRDX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX2 Products
Required fields are marked with *
My Review for All PRDX2 Products
Required fields are marked with *
0
Inquiry Basket