Recombinant Human PRDX2 protein, His-tagged
Cat.No. : | PRDX2-4027H |
Product Overview : | Recombinant Human PRDX2 protein(P32119)(2-198aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PRDX2 peroxiredoxin 2 [ Homo sapiens ] |
Official Symbol | PRDX2 |
Synonyms | PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1; |
Gene ID | 7001 |
mRNA Refseq | NM_005809 |
Protein Refseq | NP_005800 |
MIM | 600538 |
UniProt ID | P32119 |
◆ Recombinant Proteins | ||
PRDX2-870M | Recombinant Mouse PRDX2 Protein (Met1-Asn198), His-tagged | +Inquiry |
PRDX2-3590R | Recombinant Rhesus monkey PRDX2 Protein, His-tagged | +Inquiry |
PRDX2-810C | Recombinant Cynomolgus PRDX2 Protein, His-tagged | +Inquiry |
PRDX2-4743H | Recombinant Human PRDX2 protein, His-tagged | +Inquiry |
PRDX2-6209H | Recombinant Human PRDX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX2-564HCL | Recombinant Human PRDX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX2 Products
Required fields are marked with *
My Review for All PRDX2 Products
Required fields are marked with *