Recombinant Human PRDX2 protein, His-tagged

• Cat.No.: PRDX2-4027H
• Product Overview: Recombinant Human PRDX2 protein(P32119)(2-198aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-198aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.8 kDa
• AA Sequence: ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PRDX2 peroxiredoxin 2 [ Homo sapiens ]
• Official Symbol: PRDX2
• Synonyms: PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1
• Gene ID: 7001
• mRNA Refseq: NM_005809
• Protein Refseq: NP_005800
• MIM: 600538
• UniProt ID: P32119