Recombinant Human PRDX2 protein, His-tagged
| Cat.No. : | PRDX2-4027H |
| Product Overview : | Recombinant Human PRDX2 protein(P32119)(2-198aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-198aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.8 kDa |
| AA Sequence : | ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRDX2 peroxiredoxin 2 [ Homo sapiens ] |
| Official Symbol | PRDX2 |
| Synonyms | PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1; |
| Gene ID | 7001 |
| mRNA Refseq | NM_005809 |
| Protein Refseq | NP_005800 |
| MIM | 600538 |
| UniProt ID | P32119 |
| ◆ Recombinant Proteins | ||
| PRDX2-2875H | Recombinant Human Full length PRDX2 protein(1-198 aa), C-His-tagged | +Inquiry |
| PRDX2-7070M | Recombinant Mouse PRDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDX2-1241H | Active Recombinant Human PRDX2 protein, His-tagged | +Inquiry |
| PRDX2-2247H | Recombinant Human PRDX2 Protein (2-198 aa), His-tagged | +Inquiry |
| PRDX2-30464TH | Recombinant Human PRDX2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRDX2-564HCL | Recombinant Human PRDX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX2 Products
Required fields are marked with *
My Review for All PRDX2 Products
Required fields are marked with *



