Recombinant Full Length Human RCAN1 Protein, GST-tagged
| Cat.No. : | RCAN1-4708HF |
| Product Overview : | Human DSCR1 full-length ORF ( AAH02864, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 197 amino acids |
| Description : | The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
| Molecular Mass : | 47.41 kDa |
| AA Sequence : | MEEVDLRDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTQIHLS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RCAN1 regulator of calcineurin 1 [ Homo sapiens ] |
| Official Symbol | RCAN1 |
| Synonyms | RCAN1; regulator of calcineurin 1; Down syndrome critical region gene 1 , DSCR1; calcipressin-1; near DSCR proline-rich protein; Down syndrome candidate region 1; calcium and oxidant-inducible mRNA; Down syndrome critical region gene 1; down syndrome critical region protein 1; modulatory calcineurin-interacting protein 1; myocyte-enriched calcineurin-interacting protein 1; CSP1; DSC1; RCN1; DSCR1; MCIP1; ADAPT78; |
| Gene ID | 1827 |
| mRNA Refseq | NM_004414 |
| Protein Refseq | NP_004405 |
| MIM | 602917 |
| UniProt ID | P53805 |
| ◆ Recombinant Proteins | ||
| RCAN1-5347C | Recombinant Chicken RCAN1 | +Inquiry |
| RCAN1-27792TH | Recombinant Human RCAN1 | +Inquiry |
| RCAN1-4631R | Recombinant Rat RCAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RCAN1-4029H | Recombinant Human RCAN1 Protein, GST-tagged | +Inquiry |
| RCAN1-3958H | Recombinant Human RCAN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCAN1-510HCL | Recombinant Human RCAN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCAN1 Products
Required fields are marked with *
My Review for All RCAN1 Products
Required fields are marked with *
