Recombinant Full Length Human RCVRN Protein, C-Flag-tagged
Cat.No. : | RCVRN-1037HFL |
Product Overview : | Recombinant Full Length Human RCVRN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.9 kDa |
AA Sequence : | MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVF RSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKL LPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RCVRN recoverin [ Homo sapiens (human) ] |
Official Symbol | RCVRN |
Synonyms | RCV1 |
Gene ID | 5957 |
mRNA Refseq | NM_002903.3 |
Protein Refseq | NP_002894.1 |
MIM | 179618 |
UniProt ID | P35243 |
◆ Recombinant Proteins | ||
RCVRN-2233H | Recombinant Human RCVRN, GST-tagged | +Inquiry |
RCVRN-1847H | Recombinant Human RCVRN Protein (2-200 aa), His-tagged | +Inquiry |
RCVRN-1870H | Recombinant Human RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
RCVRN-3652R | Recombinant Rhesus Macaque RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
RCVRN-250H | Recombinant Human RCVRN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCVRN-2442HCL | Recombinant Human RCVRN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCVRN Products
Required fields are marked with *
My Review for All RCVRN Products
Required fields are marked with *
0
Inquiry Basket