Recombinant Full Length Human WASHC3 Protein, GST-tagged

• Cat.No.: WASHC3-2866HF
• Product Overview: Human WASHC3 full-length ORF (NP_057137.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 194 amino acids
• Description: WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Among its related pathways are Endocytosis.
• Molecular Mass: 47.6 kDa
• AA Sequence: MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ]
• Official Symbol: WASHC3
• Synonyms: CGI-116; WASHC3; WASH complex subunit 3; CCDC53; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53
• Gene ID: 51019
• mRNA Refseq: NM_016053
• Protein Refseq: NP_057137
• MIM: 619925
• UniProt ID: Q9Y3C0