Recombinant Full Length Human WASHC3 Protein, GST-tagged

Cat.No. : WASHC3-2866HF
Product Overview : Human WASHC3 full-length ORF (NP_057137.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 194 amino acids
Description : WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Among its related pathways are Endocytosis.
Molecular Mass : 47.6 kDa
AA Sequence : MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ]
Official Symbol WASHC3
Synonyms CGI-116; WASHC3; WASH complex subunit 3; CCDC53; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53
Gene ID 51019
mRNA Refseq NM_016053
Protein Refseq NP_057137
MIM 619925
UniProt ID Q9Y3C0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WASHC3 Products

Required fields are marked with *

My Review for All WASHC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon