Recombinant Full Length Human WASHC3 Protein, GST-tagged
| Cat.No. : | WASHC3-2866HF |
| Product Overview : | Human WASHC3 full-length ORF (NP_057137.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 194 amino acids |
| Description : | WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Among its related pathways are Endocytosis. |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ] |
| Official Symbol | WASHC3 |
| Synonyms | CGI-116; WASHC3; WASH complex subunit 3; CCDC53; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53 |
| Gene ID | 51019 |
| mRNA Refseq | NM_016053 |
| Protein Refseq | NP_057137 |
| MIM | 619925 |
| UniProt ID | Q9Y3C0 |
| ◆ Recombinant Proteins | ||
| WASHC3-2866HF | Recombinant Full Length Human WASHC3 Protein, GST-tagged | +Inquiry |
| WASHC3-0559H | Recombinant Human WASHC3 Protein, GST-Tagged | +Inquiry |
| Washc3-6965M | Recombinant Mouse Washc3 Protein, Myc/DDK-tagged | +Inquiry |
| WASHC3-5805H | Recombinant Human WASHC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WASHC3 Products
Required fields are marked with *
My Review for All WASHC3 Products
Required fields are marked with *
