Recombinant Human WASHC3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WASHC3-5805H |
Product Overview : | CCDC53 MS Standard C13 and N15-labeled recombinant protein (NP_057137) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Diseases associated with WASHC3 include Ritscher-Schinzel Syndrome and Spastic Paraplegia 8, Autosomal Dominant. Among its related pathways are Endocytosis. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ] |
Official Symbol | WASHC3 |
Synonyms | WASHC3; WASH complex subunit 3; CCDC53; CGI-116; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53 |
Gene ID | 51019 |
mRNA Refseq | NM_016053 |
Protein Refseq | NP_057137 |
UniProt ID | Q9Y3C0 |
◆ Recombinant Proteins | ||
Washc3-6965M | Recombinant Mouse Washc3 Protein, Myc/DDK-tagged | +Inquiry |
WASHC3-0559H | Recombinant Human WASHC3 Protein, GST-Tagged | +Inquiry |
WASHC3-2866HF | Recombinant Full Length Human WASHC3 Protein, GST-tagged | +Inquiry |
WASHC3-5805H | Recombinant Human WASHC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WASHC3 Products
Required fields are marked with *
My Review for All WASHC3 Products
Required fields are marked with *