Recombinant Human WASHC3 Protein, GST-Tagged
Cat.No. : | WASHC3-0559H |
Product Overview : | Human WASHC3 full-length ORF (NP_057137.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Among its related pathways are Endocytosis. |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQNSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ] |
Official Symbol | WASHC3 |
Synonyms | CGI-116; WASHC3; WASH complex subunit 3; CCDC53; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53 |
Gene ID | 51019 |
mRNA Refseq | NM_016053 |
Protein Refseq | NP_057137 |
UniProt ID | Q9Y3C0 |
◆ Recombinant Proteins | ||
WASHC3-0559H | Recombinant Human WASHC3 Protein, GST-Tagged | +Inquiry |
Washc3-6965M | Recombinant Mouse Washc3 Protein, Myc/DDK-tagged | +Inquiry |
WASHC3-2866HF | Recombinant Full Length Human WASHC3 Protein, GST-tagged | +Inquiry |
WASHC3-5805H | Recombinant Human WASHC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WASHC3 Products
Required fields are marked with *
My Review for All WASHC3 Products
Required fields are marked with *