Recombinant Full Length Macaca Fascicularis Abhydrolase Domain-Containing Protein 2(Abhd2) Protein, His-Tagged
Cat.No. : | RFL2237MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Abhydrolase domain-containing protein 2(ABHD2) Protein (Q4R2Y9) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG CTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQV EADLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABHD2 |
Synonyms | ABHD2; QtsA-14549; QtsA-21018; Monoacylglycerol lipase ABHD2; 2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 2; Acetylesterase; Triacylglycerol lipase |
UniProt ID | Q4R2Y9 |
◆ Recombinant Proteins | ||
ABHD2-1131M | Recombinant Mouse ABHD2 Protein | +Inquiry |
RFL-5150HF | Recombinant Full Length Human Monoacylglycerol Lipase Abhd2(Abhd2) Protein, His-Tagged | +Inquiry |
ABHD2-19R | Recombinant Rhesus Macaque ABHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD2-6465H | Recombinant Human ABHD2 protein, GST-tagged | +Inquiry |
ABHD2-3040H | Recombinant Human ABHD2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
ABHD2-9134HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD2 Products
Required fields are marked with *
My Review for All ABHD2 Products
Required fields are marked with *