Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Protransforming Growth Factor Alpha(Tgfa) Protein, His-Tagged
Cat.No. : | RFL34251MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha(TGFA) Protein (P55244) (2-121aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-121) |
Form : | Lyophilized powder |
AA Sequence : | ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TGFA |
Synonyms | TGFA; Protransforming growth factor alpha; Fragment |
UniProt ID | P55244 |
◆ Recombinant Proteins | ||
Tgfa-4535M | Recombinant Mouse Tgfa protein, hFc-tagged | +Inquiry |
TGFA-0738H | Recombinant Human TGFA protein, His-tagged | +Inquiry |
TGFA-244H | Active Recombinant Human TGFA Protein | +Inquiry |
TGFA-7H | Active Recombinant Human Tumor Necrosis Factor | +Inquiry |
TGFA-522H | Recombinant Human TGFA protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *