Recombinant Full Length Rabbit Cd63 Antigen(Cd63) Protein, His-Tagged
| Cat.No. : | RFL3211OF |
| Product Overview : | Recombinant Full Length Rabbit CD63 antigen(CD63) Protein (Q28709) (2-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Oryctolagus cuniculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-238) |
| Form : | Lyophilized powder |
| AA Sequence : | AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTITHGATPGSLLPVVIIAVG AFLFLVAFVGCCGTCKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNKDFRQ QMQNYSTDNQTALILDRMQKDFTCCGAANYTDWATIPGMTRDRVPDSCCVNVTSGCGVKF NVKDIYVEGCVEKIGLWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD63 |
| Synonyms | CD63; CD63 antigen; CD antigen CD63 |
| UniProt ID | Q28709 |
| ◆ Recombinant Proteins | ||
| CD63-180HFL | Recombinant Full Length Human CD63 Protein, C-Flag-tagged | +Inquiry |
| RFL8789FF | Recombinant Full Length Cat Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
| CD63-159H | Recombinant Human CD63 molecule Protein, Tag Free | +Inquiry |
| Cd63-878M | Recombinant Mouse Cd63 Protein, Fc-tagged | +Inquiry |
| CD63-0840H | Recombinant Human CD63 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
| CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
| CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
| CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *



