Recombinant Full Length Rabbit Cd63 Antigen(Cd63) Protein, His-Tagged
Cat.No. : | RFL3211OF |
Product Overview : | Recombinant Full Length Rabbit CD63 antigen(CD63) Protein (Q28709) (2-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-238) |
Form : | Lyophilized powder |
AA Sequence : | AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTITHGATPGSLLPVVIIAVG AFLFLVAFVGCCGTCKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNKDFRQ QMQNYSTDNQTALILDRMQKDFTCCGAANYTDWATIPGMTRDRVPDSCCVNVTSGCGVKF NVKDIYVEGCVEKIGLWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD63 |
Synonyms | CD63; CD63 antigen; CD antigen CD63 |
UniProt ID | Q28709 |
◆ Recombinant Proteins | ||
Cd63-845M | Recombinant Mouse Cd63 Protein, MYC/DDK-tagged | +Inquiry |
RFL36047RF | Recombinant Full Length Rat Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-396M | Recombinant Mouse CD63 Protein (103-203 aa), GST-tagged | +Inquiry |
CD63-3890H | Recombinant Human CD63 protein, His-tagged | +Inquiry |
Cd63-880M | Recombinant Mouse Cd63 protein (Ala103-Ile203) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *
0
Inquiry Basket