Recombinant Rat Fc epsilon receptor Ia Protein, His tagged
Cat.No. : | FCER1A-2304R |
Product Overview : | Recombinant Rat FCER1A Protein with His tag was expressed in HEK293F. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-200 aa |
Description : | Predicted to enable IgE binding activity and high-affinity IgE receptor activity. Predicted to be involved in several processes, including eosinophil degranulation; type 2 immune response; and type I hypersensitivity. Predicted to act upstream of or within several processes, including leukotriene biosynthetic process; positive regulation of immune effector process; and positive regulation of macromolecule metabolic process. Predicted to be located in cell surface and plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human FCER1A (Fc epsilon receptor Ia). |
Tag : | C-His |
Molecular Mass : | 23 kDa |
AA Sequence : | MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Liquid in 25 mM Tris-Hcl, pH7.4, 150 mM NaCl, 0.05% DDM |
Concentration : | 0.5 mg/mL |
Gene Name | Fcer1a Fc epsilon receptor Ia [ Rattus norvegicus (Norway rat) ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; fcERI; alpha polypeptide; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; Fc receptor, IgE, high affinity I, alpha polypeptide; Iger01; RATIGER01 |
Gene ID | 25047 |
mRNA Refseq | NM_012724 |
Protein Refseq | NP_036856 |
UniProt ID | P12371 |
◆ Recombinant Proteins | ||
FCER1A-237H | Recombinant Human FCER1A | +Inquiry |
FCER1A-725H | Active Recombinant Human FCER1A, His-tagged | +Inquiry |
FCER1A-28166TH | Recombinant Human FCER1A, GST-tagged | +Inquiry |
FCER1A-5467H | Recombinant Human FCER1A protein, hFc-tagged | +Inquiry |
FCER1A-338H | Recombinant Human FCER1A Protein(Val26-Gln205), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
0
Inquiry Basket