Recombinant Full Length Rat Interleukin-2 Receptor Subunit Beta(Il2Rb) Protein, His-Tagged
Cat.No. : | RFL6695RF |
Product Overview : | Recombinant Full Length Rat Interleukin-2 receptor subunit beta(Il2rb) Protein (P26896) (27-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-537) |
Form : | Lyophilized powder |
AA Sequence : | AVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCHIHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRVKTCTFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWEDASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPMAFRTRPADPKEIFPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGGDLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASCFTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDYCAFPPRDDLLLFSPSMSTPNTAYGNSITPEERPPLSLQEGLPSLASPDLMGLQHPLELELGDDGEGMSTNSSGQQASVPEAALMGTTKTEARPVLTLNTDAYLSLQELQAQDSAHLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il2rb |
Synonyms | Il2rb; Interleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122 |
UniProt ID | P26896 |
◆ Recombinant Proteins | ||
IL2RB-5196H | Recombinant Human IL2RB Protein | +Inquiry |
IL2RB-9511R | Active Recombinant Rat IL2RB protein, His&Twin-Strep-tagged | +Inquiry |
IL2RB-454R | Active Recombinant Rhesus IL2RB protein(Met1-Asp239), hFc-tagged | +Inquiry |
IL2RB-619C | Recombinant Cynomolgus IL2RB protein, His-tagged, Biotinylated | +Inquiry |
IL2RB-619R | Active Recombinant Rhesus IL2RB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
IL2RB-744MCL | Recombinant Mouse IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il2rb Products
Required fields are marked with *
My Review for All Il2rb Products
Required fields are marked with *
0
Inquiry Basket