Recombinant Full Length Schizosaccharomyces Pombe Protein Transport Protein Got1(Got1) Protein, His-Tagged
Cat.No. : | RFL7524SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Protein transport protein got1(got1) Protein (Q9USJ2) (1-129aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-129) |
Form : | Lyophilized powder |
AA Sequence : | MWLSDLQKIGVGTTALGFLFMIMGIFMFFDGPLLSLGNLLLVFGFFMIAGFSKSVSFFLR KDRMLGSISFFSGLLLTLFHFPIIGFFVECLGFFNLFKVFYPLIISFLRTVPYIGPYIDR LTSYQQSPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | got1 |
Synonyms | got1; SPCC4B3.02c; Protein transport protein got1; Golgi transport protein 1 |
UniProt ID | Q9USJ2 |
◆ Recombinant Proteins | ||
GOT1-27058TH | Recombinant Human GOT1, His-tagged | +Inquiry |
GOT1-1006H | Recombinant Human GOT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GOT1-2588H | Recombinant Human GOT1 protein | +Inquiry |
RFL7524SF | Recombinant Full Length Schizosaccharomyces Pombe Protein Transport Protein Got1(Got1) Protein, His-Tagged | +Inquiry |
GOT1-2577H | Recombinant Human GOT1, His-tagged | +Inquiry |
◆ Native Proteins | ||
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOT1-5824HCL | Recombinant Human GOT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All got1 Products
Required fields are marked with *
My Review for All got1 Products
Required fields are marked with *
0
Inquiry Basket