Recombinant Human ABCC1 Protein, GST-Tagged

Cat.No. : ABCC1-042H
Product Overview : Human ABCC1 partial ORF ( NP_004987, 816 a.a. - 915 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown. [provided by RefSeq, Apr 2012]
Molecular Mass : 36.74 kDa
AA Sequence : MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [ Homo sapiens ]
Official Symbol ABCC1
Synonyms ABCC1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; MRP, MRP1, multidrug resistance associated protein 1; multidrug resistance-associated protein 1; GS X; LTC4 transporter; leukotriene C(4) transporter; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex13and 14; ATP-binding cassette transporter variant ABCC1delta-ex25& 26; MRP; ABCC; GS-X; MRP1; ABC29; DKFZp781G125; DKFZp686N04233;
Gene ID 4363
mRNA Refseq NM_004996
Protein Refseq NP_004987
MIM 158343
UniProt ID P33527

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC1 Products

Required fields are marked with *

My Review for All ABCC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon