Recombinant Human ABCC1 Protein, GST-Tagged
Cat.No. : | ABCC1-042H |
Product Overview : | Human ABCC1 partial ORF ( NP_004987, 816 a.a. - 915 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown. [provided by RefSeq, Apr 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [ Homo sapiens ] |
Official Symbol | ABCC1 |
Synonyms | ABCC1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; MRP, MRP1, multidrug resistance associated protein 1; multidrug resistance-associated protein 1; GS X; LTC4 transporter; leukotriene C(4) transporter; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex13and 14; ATP-binding cassette transporter variant ABCC1delta-ex25& 26; MRP; ABCC; GS-X; MRP1; ABC29; DKFZp781G125; DKFZp686N04233; |
Gene ID | 4363 |
mRNA Refseq | NM_004996 |
Protein Refseq | NP_004987 |
MIM | 158343 |
UniProt ID | P33527 |
◆ Recombinant Proteins | ||
ABCC1-1897C | Recombinant Chicken ABCC1 | +Inquiry |
ABCC1-10C | Recombinant Cynomolgus Monkey ABCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCC1-285H | Recombinant Human ABCC1 | +Inquiry |
ABCC1-260C | Recombinant Cynomolgus ABCC1 Protein, His-tagged | +Inquiry |
ABCC1-2402H | Recombinant Human ABCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC1 Products
Required fields are marked with *
My Review for All ABCC1 Products
Required fields are marked with *