Recombinant Human ABCC1 protein(871-960 aa), C-His-tagged
Cat.No. : | ABCC1-2727H |
Product Overview : | Recombinant Human ABCC1 protein(P33527)(871-960 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 871-960 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | STEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL |
Gene Name | ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [ Homo sapiens ] |
Official Symbol | ABCC1 |
Synonyms | ABCC1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; MRP, MRP1, multidrug resistance associated protein 1; multidrug resistance-associated protein 1; GS X; LTC4 transporter; leukotriene C(4) transporter; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex13and 14; ATP-binding cassette transporter variant ABCC1delta-ex25& 26; MRP; ABCC; GS-X; MRP1; ABC29; DKFZp781G125; DKFZp686N04233; |
Gene ID | 4363 |
mRNA Refseq | NM_004996 |
Protein Refseq | NP_004987 |
MIM | 158343 |
UniProt ID | P33527 |
◆ Recombinant Proteins | ||
ABCC1-1897C | Recombinant Chicken ABCC1 | +Inquiry |
ABCC1-3257H | Recombinant Human ABCC1 protein, His-tagged | +Inquiry |
ABCC1-2727H | Recombinant Human ABCC1 protein(871-960 aa), C-His-tagged | +Inquiry |
ABCC1-285H | Recombinant Human ABCC1 | +Inquiry |
ABCC1-2325H | Recombinant Human ABCC1 Protein (1248-1531 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC1 Products
Required fields are marked with *
My Review for All ABCC1 Products
Required fields are marked with *
0
Inquiry Basket