Recombinant Human ABCC1 protein(871-960 aa), C-His-tagged
| Cat.No. : | ABCC1-2727H |
| Product Overview : | Recombinant Human ABCC1 protein(P33527)(871-960 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 871-960 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | STEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL |
| Gene Name | ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [ Homo sapiens ] |
| Official Symbol | ABCC1 |
| Synonyms | ABCC1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; MRP, MRP1, multidrug resistance associated protein 1; multidrug resistance-associated protein 1; GS X; LTC4 transporter; leukotriene C(4) transporter; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex13and 14; ATP-binding cassette transporter variant ABCC1delta-ex25& 26; MRP; ABCC; GS-X; MRP1; ABC29; DKFZp781G125; DKFZp686N04233; |
| Gene ID | 4363 |
| mRNA Refseq | NM_004996 |
| Protein Refseq | NP_004987 |
| MIM | 158343 |
| UniProt ID | P33527 |
| ◆ Recombinant Proteins | ||
| ABCC1-2727H | Recombinant Human ABCC1 protein(871-960 aa), C-His-tagged | +Inquiry |
| ABCC1-042H | Recombinant Human ABCC1 Protein, GST-Tagged | +Inquiry |
| ABCC1-2325H | Recombinant Human ABCC1 Protein (1248-1531 aa), His-tagged | +Inquiry |
| Abcc1-1458M | Recombinant Mouse Abcc1 protein, His & T7-tagged | +Inquiry |
| ABCC1-10C | Recombinant Cynomolgus Monkey ABCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC1 Products
Required fields are marked with *
My Review for All ABCC1 Products
Required fields are marked with *



