Recombinant Human ACTC1 Protein, GST-tagged
| Cat.No. : | ACTC1-214H |
| Product Overview : | Human ACTC full-length ORF ( AAH09978.1, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 68.4 kDa |
| AA Sequence : | MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ] |
| Official Symbol | ACTC1 |
| Synonyms | ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4; |
| Gene ID | 70 |
| mRNA Refseq | NM_005159 |
| Protein Refseq | NP_005150 |
| MIM | 102540 |
| UniProt ID | P68032 |
| ◆ Recombinant Proteins | ||
| Actc1-3089M | Recombinant Mouse Actc1, His-tagged | +Inquiry |
| ACTC1-268H | Recombinant Human ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACTC1-283M | Recombinant Mouse ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACTC1-6835H | Recombinant Human ACTC1 protein, His & T7-tagged | +Inquiry |
| Actc1-5333R | Recombinant Rat Actc1 protein | +Inquiry |
| ◆ Native Proteins | ||
| ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
| ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
| ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
| ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTC1-9065HCL | Recombinant Human ACTC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTC1 Products
Required fields are marked with *
My Review for All ACTC1 Products
Required fields are marked with *
