Recombinant Human ACTC1 protein, His-tagged
| Cat.No. : | ACTC1-4785H |
| Product Overview : | Recombinant Human ACTC1 protein(P68032)(3-377aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 3-377aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF |
| Gene Name | ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ] |
| Official Symbol | ACTC1 |
| Synonyms | ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4; |
| Gene ID | 70 |
| mRNA Refseq | NM_005159 |
| Protein Refseq | NP_005150 |
| MIM | 102540 |
| UniProt ID | P68032 |
| ◆ Recombinant Proteins | ||
| ACTC1-244H | Recombinant Human ACTC1 protein, GST-tagged | +Inquiry |
| Actc1-813M | Recombinant Mouse Actc1 Protein, MYC/DDK-tagged | +Inquiry |
| ACTC1-4785H | Recombinant Human ACTC1 protein, His-tagged | +Inquiry |
| Actc1-5333R | Recombinant Rat Actc1 protein | +Inquiry |
| Actc1-5334R | Recombinant Rat Actc1 protein | +Inquiry |
| ◆ Native Proteins | ||
| ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
| ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
| ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
| ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTC1-9065HCL | Recombinant Human ACTC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTC1 Products
Required fields are marked with *
My Review for All ACTC1 Products
Required fields are marked with *
