Recombinant Human ACTC1 protein, His-tagged
Cat.No. : | ACTC1-4785H |
Product Overview : | Recombinant Human ACTC1 protein(P68032)(3-377aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 3-377aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF |
Gene Name | ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ] |
Official Symbol | ACTC1 |
Synonyms | ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4; |
Gene ID | 70 |
mRNA Refseq | NM_005159 |
Protein Refseq | NP_005150 |
MIM | 102540 |
UniProt ID | P68032 |
◆ Recombinant Proteins | ||
ACTC1-4785H | Recombinant Human ACTC1 protein, His-tagged | +Inquiry |
Actc1-3089M | Recombinant Mouse Actc1, His-tagged | +Inquiry |
ACTC1-1209HFL | Recombinant Full Length Human ACTC1 Protein, C-Flag-tagged | +Inquiry |
ACTC1-244H | Recombinant Human ACTC1 protein, GST-tagged | +Inquiry |
ACTC1-268H | Recombinant Human ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTC1-9065HCL | Recombinant Human ACTC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTC1 Products
Required fields are marked with *
My Review for All ACTC1 Products
Required fields are marked with *
0
Inquiry Basket