"ACTL6A" Related Products

Expand
Expand

Recombinant Human ACTL6A protein, T7-tagged

Cat.No.: ACTL6A-139H
Product Overview: Recombinant human ACTL6A protein fused with 15aa (T7) at N-terminal, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQENGRGEFSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKG KQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKL TELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQ EMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVH YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFT DRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for studying SWI/SNF-like BAF complex in vitro.2. Active recombinant protein, may be used for ELISA based DNA / protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ACTL6A actin-like 6A [ Homo sapiens ]
Official Symbol: ACTL6A
Synonyms: ACTL6A; actin-like 6A; actin-like protein 6A; actin related protein 4; Actl6; Arp4; BAF complex 53 kDa subunit; BAF53A; Baf53a; BRG1 associated factor; ACTL6; ARPN-BETA;
Gene ID: 86
mRNA Refseq: NM_004301
Protein Refseq: NP_004292
MIM: 604958
UniProt ID: O96019
Chromosome Location: 3q26.33
Pathway: C-MYC pathway, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function: ATP binding; chromatin binding; protein binding; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.