Recombinant Human ACTL6A protein, T7-tagged
Cat.No. : | ACTL6A-139H |
Product Overview : | Recombinant human ACTL6A protein fused with 15aa (T7) at N-terminal, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQENGRGEFSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKG KQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKL TELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQ EMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVH YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFT DRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for studying SWI/SNF-like BAF complex in vitro.2. Active recombinant protein, may be used for ELISA based DNA / protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | ACTL6A actin-like 6A [ Homo sapiens ] |
Official Symbol | ACTL6A |
Synonyms | ACTL6A; actin-like 6A; actin-like protein 6A; actin related protein 4; Actl6; Arp4; BAF complex 53 kDa subunit; BAF53A; Baf53a; BRG1 associated factor; ACTL6; ARPN-BETA; |
Gene ID | 86 |
mRNA Refseq | NM_004301 |
Protein Refseq | NP_004292 |
MIM | 604958 |
UniProt ID | O96019 |
Chromosome Location | 3q26.33 |
Pathway | C-MYC pathway, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | ATP binding; chromatin binding; protein binding; transcription coactivator activity; |
◆ Recombinant Proteins | ||
ACTL6A-139H | Recombinant Human ACTL6A protein, T7-tagged | +Inquiry |
ACTL6A-222H | Recombinant Human ACTL6A Protein, GST-tagged | +Inquiry |
Actl6a-1515M | Recombinant Mouse Actl6a Protein, Myc/DDK-tagged | +Inquiry |
ACTL6A-50R | Recombinant Rhesus Macaque ACTL6A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL6A-61H | Recombinant Human Actin-like 6A, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL6A-9061HCL | Recombinant Human ACTL6A 293 Cell Lysate | +Inquiry |
ACTL6A-9062HCL | Recombinant Human ACTL6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTL6A Products
Required fields are marked with *
My Review for All ACTL6A Products
Required fields are marked with *