Recombinant Human ADAM15 protein, His-tagged
Cat.No. : | ADAM15-3697H |
Product Overview : | Recombinant Human ADAM15 protein(362-486 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 362-486 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADAM15 ADAM metallopeptidase domain 15 [ Homo sapiens ] |
Official Symbol | ADAM15 |
Synonyms | ADAM15; ADAM metallopeptidase domain 15; a disintegrin and metalloproteinase domain 15 (metargidin); disintegrin and metalloproteinase domain-containing protein 15; MDC15; metargidin; MDC-15; ADAM 15; metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15; |
Gene ID | 8751 |
mRNA Refseq | NM_003815 |
Protein Refseq | NP_003806 |
MIM | 605548 |
UniProt ID | Q13444 |
◆ Recombinant Proteins | ||
ADAM15-228H | Recombinant Human ADAM15 Protein, His-tagged | +Inquiry |
ADAM15-2422H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
ADAM15-863HF | Recombinant Full Length Human ADAM15 Protein, GST-tagged | +Inquiry |
ADAM15-948M | Active Recombinant Mouse ADAM15 Protein, His-tagged | +Inquiry |
ADAM15-3697H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM15-1820MCL | Recombinant Mouse ADAM15 cell lysate | +Inquiry |
ADAM15-001HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
ADAM15-2808HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM15 Products
Required fields are marked with *
My Review for All ADAM15 Products
Required fields are marked with *