Recombinant Human ADAM15 protein, His-tagged
| Cat.No. : | ADAM15-3697H |
| Product Overview : | Recombinant Human ADAM15 protein(362-486 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 362-486 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ADAM15 ADAM metallopeptidase domain 15 [ Homo sapiens ] |
| Official Symbol | ADAM15 |
| Synonyms | ADAM15; ADAM metallopeptidase domain 15; a disintegrin and metalloproteinase domain 15 (metargidin); disintegrin and metalloproteinase domain-containing protein 15; MDC15; metargidin; MDC-15; ADAM 15; metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15; |
| Gene ID | 8751 |
| mRNA Refseq | NM_003815 |
| Protein Refseq | NP_003806 |
| MIM | 605548 |
| UniProt ID | Q13444 |
| ◆ Recombinant Proteins | ||
| ADAM15-2422H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
| ADAM15-1717H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
| ADAM15-948M | Active Recombinant Mouse ADAM15 Protein, His-tagged | +Inquiry |
| ADAM15-3697H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
| ADAM15-1186H | Recombinant Human ADAM15 Protein (207-452 aa), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAM15-001HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
| ADAM15-2808HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
| ADAM15-1820MCL | Recombinant Mouse ADAM15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM15 Products
Required fields are marked with *
My Review for All ADAM15 Products
Required fields are marked with *
