Recombinant Human ADCY1 protein, GST-tagged

Cat.No. : ADCY1-18434H
Product Overview : Recombinant Human ADCY1 protein(1050-1119 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Protein Length : 1050-1119 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : LTYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
Gene Name ADCY1 adenylate cyclase 1 (brain) [ Homo sapiens ]
Official Symbol ADCY1
Synonyms ADCY1; adenylate cyclase 1 (brain); adenylate cyclase type 1; AC1; adenyl cyclase; adenylyl cyclase 1; adenylate cyclase type I; ATP pyrophosphate-lyase 1; 3,5-cyclic AMP synthetase; Ca(2+)/calmodulin-activated adenylyl cyclase;
Gene ID 107
mRNA Refseq NM_021116
Protein Refseq NP_066939
MIM 103072
UniProt ID Q08828

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY1 Products

Required fields are marked with *

My Review for All ADCY1 Products

Required fields are marked with *

0
cart-icon