Recombinant Human ADCY1 protein, GST-tagged
Cat.No. : | ADCY1-18434H |
Product Overview : | Recombinant Human ADCY1 protein(1050-1119 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1050-1119 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LTYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA |
Gene Name | ADCY1 adenylate cyclase 1 (brain) [ Homo sapiens ] |
Official Symbol | ADCY1 |
Synonyms | ADCY1; adenylate cyclase 1 (brain); adenylate cyclase type 1; AC1; adenyl cyclase; adenylyl cyclase 1; adenylate cyclase type I; ATP pyrophosphate-lyase 1; 3,5-cyclic AMP synthetase; Ca(2+)/calmodulin-activated adenylyl cyclase; |
Gene ID | 107 |
mRNA Refseq | NM_021116 |
Protein Refseq | NP_066939 |
MIM | 103072 |
UniProt ID | Q08828 |
◆ Recombinant Proteins | ||
ADCY1-0080H | Recombinant Human ADCY1 Protein (Arg835-Asn1061), N-His-tagged | +Inquiry |
ADCY1-1342M | Recombinant Mouse ADCY1 Protein | +Inquiry |
ADCY1-336M | Recombinant Mouse ADCY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCY1-18434H | Recombinant Human ADCY1 protein, GST-tagged | +Inquiry |
ADCY1-6841H | Recombinant Human ADCY1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCY1 Products
Required fields are marked with *
My Review for All ADCY1 Products
Required fields are marked with *