Recombinant Human ADH1A Protein, GST-tagged
Cat.No. : | ADH1A-344H |
Product Overview : | Human ADH1A partial ORF ( NP_000658, 298 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 34.32 kDa |
AA Sequence : | DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADH1A alcohol dehydrogenase 1A (class I), alpha polypeptide [ Homo sapiens ] |
Official Symbol | ADH1A |
Synonyms | ADH1A; alcohol dehydrogenase 1A (class I), alpha polypeptide; ADH1; alcohol dehydrogenase 1A; ADH, alpha subunit; aldehyde reductase; alcohol dehydrogenase subunit alpha; alcohol dehydrogenase 1 (class I), alpha polypeptide; |
Gene ID | 124 |
mRNA Refseq | NM_000667 |
Protein Refseq | NP_000658 |
MIM | 103700 |
UniProt ID | P07327 |
◆ Recombinant Proteins | ||
ADH1A-3601H | Recombinant Human ADH1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADH1A-9416H | Recombinant Human ADH1A protein, His-tagged | +Inquiry |
ADH1A-0086H | Recombinant Human ADH1A Protein (M1-F375), Tag Free | +Inquiry |
ADH1A-245R | Recombinant Rhesus monkey ADH1A Protein, His-tagged | +Inquiry |
ADH1A-73R | Recombinant Rhesus Macaque ADH1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH1A Products
Required fields are marked with *
My Review for All ADH1A Products
Required fields are marked with *
0
Inquiry Basket