Recombinant Human AGTR1 protein, His-GST&Myc-tagged
| Cat.No. : | AGTR1-9722H |
| Product Overview : | Recombinant Human AGTR1 protein(P30556)(306-356aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 306-356aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCF |
| Gene Name | AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ] |
| Official Symbol | AGTR1 |
| Synonyms | AGTR1; angiotensin II receptor, type 1; AGTR1B, angiotensin receptor 1B; type-1 angiotensin II receptor; AG2S; AGTR1A; AT1; AT1B; AT2R1; AT2R1A; AT2R1B; HAT1R; AT1AR; AT1BR; angiotensin receptor 1; angiotensin receptor 1B; angiotensin II type-1 receptor; type-1B angiotensin II receptor; AT1R; AGTR1B; |
| Gene ID | 185 |
| mRNA Refseq | NM_000685 |
| Protein Refseq | NP_000676 |
| MIM | 106165 |
| UniProt ID | P30556 |
| ◆ Recombinant Proteins | ||
| AGTR1-29H | Recombinant Human AGTR1, GST-tagged | +Inquiry |
| AGTR1-01HFL | Recombinant Full Length Human AGTR1 Protein, Flag tagged | +Inquiry |
| RFL-20399BF | Recombinant Full Length Bovine Type-1 Angiotensin Ii Receptor(Agtr1) Protein, His-Tagged | +Inquiry |
| AGTR1-784H | Recombinant Human AGTR1 protein, His&Myc-tagged | +Inquiry |
| RFL-20427SF | Recombinant Full Length Pig Type-1 Angiotensin Ii Receptor(Agtr1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGTR1-8970HCL | Recombinant Human AGTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTR1 Products
Required fields are marked with *
My Review for All AGTR1 Products
Required fields are marked with *
