Recombinant Human ALAD Protein, GST-tagged
Cat.No. : | ALAD-428H |
Product Overview : | Human ALAD full-length ORF ( NP_000022.2, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 63.6 kDa |
AA Sequence : | MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALAD aminolevulinate dehydratase [ Homo sapiens ] |
Official Symbol | ALAD |
Synonyms | ALAD; aminolevulinate dehydratase; aminolevulinate, delta , dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase; aminolevulinate, delta-, dehydratase; MGC5057; |
Gene ID | 210 |
mRNA Refseq | NM_000031 |
Protein Refseq | NP_000022 |
MIM | 125270 |
UniProt ID | P13716 |
◆ Recombinant Proteins | ||
ALAD-5496C | Recombinant Chicken ALAD | +Inquiry |
ALAD-42C | Recombinant Cynomolgus Monkey ALAD Protein, His (Fc)-Avi-tagged | +Inquiry |
Alad-513R | Recombinant Rat Alad Protein, His-tagged | +Inquiry |
ALAD-2413Z | Recombinant Zebrafish ALAD | +Inquiry |
ALAD-1512M | Recombinant Mouse ALAD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALAD Products
Required fields are marked with *
My Review for All ALAD Products
Required fields are marked with *
0
Inquiry Basket