Recombinant Human ALPI Protein, GST-tagged

• Cat.No.: ALPI-490H
• Product Overview: Human ALPI partial ORF ( NP_001622, 74 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014]
• Molecular Mass: 35.53 kDa
• AA Sequence: LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALPI alkaline phosphatase, intestinal [ Homo sapiens ]
• Official Symbol: ALPI
• Synonyms: ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase; Kasahara isozyme; glycerophosphatase; alkaline phosphomonoesterase; intestinal alkaline phosphatase; IAP
• Gene ID: 248
• mRNA Refseq: NM_001631
• Protein Refseq: NP_001622
• MIM: 171740
• UniProt ID: P09923