Recombinant Human ALPI Protein, GST-tagged
| Cat.No. : | ALPI-490H |
| Product Overview : | Human ALPI partial ORF ( NP_001622, 74 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014] |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens ] |
| Official Symbol | ALPI |
| Synonyms | ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase; Kasahara isozyme; glycerophosphatase; alkaline phosphomonoesterase; intestinal alkaline phosphatase; IAP; |
| Gene ID | 248 |
| mRNA Refseq | NM_001631 |
| Protein Refseq | NP_001622 |
| MIM | 171740 |
| UniProt ID | P09923 |
| ◆ Recombinant Proteins | ||
| ALPI-513H | Active Recombinant Human ALPI Protein, Fc-tagged | +Inquiry |
| Alpi-654R | Recombinant Rat Alpi protein(21-511aa), His-tagged | +Inquiry |
| ALPI-490H | Recombinant Human ALPI Protein, GST-tagged | +Inquiry |
| ALPI-024H | Recombinant Human ALPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ALPI-3670H | Recombinant Human ALPI protein, rFc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
| ALPI-8341C | Native Calf ALPI | +Inquiry |
| ALPI-8348B | Native Bovine ALPI | +Inquiry |
| BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
| IAP-8323C | Active Native Bovine IAP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
| ALPI-471HKCL | Human ALPI Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *



