Recombinant Human ALPI Protein, GST-tagged
Cat.No. : | ALPI-490H |
Product Overview : | Human ALPI partial ORF ( NP_001622, 74 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens ] |
Official Symbol | ALPI |
Synonyms | ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase; Kasahara isozyme; glycerophosphatase; alkaline phosphomonoesterase; intestinal alkaline phosphatase; IAP; |
Gene ID | 248 |
mRNA Refseq | NM_001631 |
Protein Refseq | NP_001622 |
MIM | 171740 |
UniProt ID | P09923 |
◆ Recombinant Proteins | ||
ALPI-514H | Active Recombinant Human ALPI Protein, His-tagged | +Inquiry |
ALPI-69HFL | Recombinant Full Length Human ALPI Protein, C-Flag-tagged | +Inquiry |
ALPI-326H | Recombinant Human ALPI Protein, His (Fc)-Avi-tagged | +Inquiry |
ALPI-1326H | Recombinant Human ALPI Protein (20-503 aa), His-tagged | +Inquiry |
ALPI-2617H | Recombinant Human ALPI protein(291-370 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
ALPI-8341C | Native Calf ALPI | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *