Recombinant Human AMY1A protein, GST-tagged

Cat.No. : AMY1A-533H
Product Overview : Human AMY1A partial ORF ( NP_001008222, 172 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.88 kDa
AA Sequence : VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMY1A amylase, alpha 1A (salivary) [ Homo sapiens ]
Official Symbol AMY1A
Synonyms AMY1A; amylase, alpha 1A (salivary); AMY1, amylase, alpha 1A; salivary; alpha-amylase 1; glycogenase; salivary alpha-amylase; salivary amylase alpha 1A; amylase, salivary, alpha-1A; 1,4-alpha-D-glucan glucanohydrolase 1; AMY1; AMY1B; AMY1C;
Gene ID 276
mRNA Refseq NM_001008221
Protein Refseq NP_001008222
MIM 104700
UniProt ID P04745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMY1A Products

Required fields are marked with *

My Review for All AMY1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon