Recombinant Human APOC2 protein, GST-tagged
Cat.No. : | APOC2-705H |
Product Overview : | Human APOC2 full-length ORF ( ENSP00000252490, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011] |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOC2 apolipoprotein C-II [ Homo sapiens ] |
Official Symbol | APOC2 |
Synonyms | APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082; |
Gene ID | 344 |
mRNA Refseq | NM_000483 |
Protein Refseq | NP_000474 |
MIM | 608083 |
UniProt ID | P02655 |
◆ Recombinant Proteins | ||
Apoc2-817M | Recombinant Mouse Apoc2 Protein, MYC/DDK-tagged | +Inquiry |
APOC2-916H | Recombinant Human APOC2 Protein, His-tagged | +Inquiry |
APOC2-1127HF | Recombinant Full Length Human APOC2 Protein, GST-tagged | +Inquiry |
Apoc2-3569C | Recombinant Cavia porcellus (Guinea pig) Apoc2, GST-tagged | +Inquiry |
APOC2-634M | Recombinant Mouse APOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC2-8783HCL | Recombinant Human APOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC2 Products
Required fields are marked with *
My Review for All APOC2 Products
Required fields are marked with *