Recombinant Human APOC2 protein, His-SUMO-tagged
Cat.No. : | APOC2-2538H |
Product Overview : | Recombinant Human APOC2 protein(P02655)(23-101aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-101aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APOC2 apolipoprotein C-II [ Homo sapiens ] |
Official Symbol | APOC2 |
Synonyms | APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082; |
Gene ID | 344 |
mRNA Refseq | NM_000483 |
Protein Refseq | NP_000474 |
MIM | 608083 |
UniProt ID | P02655 |
◆ Recombinant Proteins | ||
Apoc2-222R | Recombinant Rat Apoc2 Protein, His-tagged | +Inquiry |
APOC2-221H | Recombinant Human APOC2 Protein, His&GST-tagged | +Inquiry |
Apoc2-2087M | Recombinant Mouse Apoc2 protein, His & GST-tagged | +Inquiry |
APOC2-196R | Recombinant Rhesus Macaque APOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOC2-367R | Recombinant Rhesus monkey APOC2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC2-8783HCL | Recombinant Human APOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC2 Products
Required fields are marked with *
My Review for All APOC2 Products
Required fields are marked with *