Recombinant Human APOC2 protein, His-SUMO-tagged
| Cat.No. : | APOC2-2538H |
| Product Overview : | Recombinant Human APOC2 protein(P02655)(23-101aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-101aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | APOC2 apolipoprotein C-II [ Homo sapiens ] |
| Official Symbol | APOC2 |
| Synonyms | APOC2; apolipoprotein C-II; apolipoprotein C2; APO-CII; APOC-II; MGC75082; |
| Gene ID | 344 |
| mRNA Refseq | NM_000483 |
| Protein Refseq | NP_000474 |
| MIM | 608083 |
| UniProt ID | P02655 |
| ◆ Recombinant Proteins | ||
| Apoc2-2086G | Recombinant Guinea pig Apoc2 protein, His & GST-tagged | +Inquiry |
| APOC2-2085H | Recombinant Horse APOC2 protein, His & T7-tagged | +Inquiry |
| Apoc2-3569C | Recombinant Cavia porcellus (Guinea pig) Apoc2, GST-tagged | +Inquiry |
| APOC2-439HFL | Recombinant Full Length Human APOC2 Protein, C-Flag-tagged | +Inquiry |
| APOC2-362H | Recombinant Human APOC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
| APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
| APOC2-27332TH | Native Human APOC2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOC2-8783HCL | Recombinant Human APOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC2 Products
Required fields are marked with *
My Review for All APOC2 Products
Required fields are marked with *
