Recombinant Human ARF6 protein, GST-tagged
Cat.No. : | ARF6-749H |
Product Overview : | Human ARF6 full-length ORF ( AAH08918, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.99 kDa |
AA Sequence : | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARF6 ADP-ribosylation factor 6 [ Homo sapiens ] |
Official Symbol | ARF6 |
Synonyms | ARF6; ADP-ribosylation factor 6; DKFZp564M0264; |
Gene ID | 382 |
mRNA Refseq | NM_001663 |
Protein Refseq | NP_001654 |
MIM | 600464 |
UniProt ID | P62330 |
◆ Recombinant Proteins | ||
ARF6-408R | Recombinant Rat ARF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARF6-2545H | Recombinant Human ARF6 protein, His-SUMO-tagged | +Inquiry |
Arf6-638M | Recombinant Mouse Arf6 Protein, MYC/DDK-tagged | +Inquiry |
ARF6-9803H | Recombinant Human ARF, His-tagged | +Inquiry |
ARF6-1184HF | Recombinant Full Length Human ARF6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF6-8756HCL | Recombinant Human ARF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARF6 Products
Required fields are marked with *
My Review for All ARF6 Products
Required fields are marked with *
0
Inquiry Basket