Recombinant Human ARPC2 protein, GST-tagged

Cat.No. : ARPC2-846H
Product Overview : Human ARPC2 full-length ORF ( AAH00590, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
Molecular Mass : 58.74 kDa
AA Sequence : MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPC2 actin related protein 2/3 complex, subunit 2, 34kDa [ Homo sapiens ]
Official Symbol ARPC2
Synonyms ARPC2; actin related protein 2/3 complex, subunit 2, 34kDa; actin related protein 2/3 complex, subunit 2 (34 kD); actin-related protein 2/3 complex subunit 2; ARC34; p34 Arc; arp2/3 complex 34 kDa subunit; ARP2/3 protein complex subunit 34; PRO2446; p34-Arc; PNAS-139;
Gene ID 10109
mRNA Refseq NM_005731
Protein Refseq NP_005722
MIM 604224
UniProt ID O15144

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Can you provide a characterization of your recombinant ARPC2 protein? Is the recombinant ARPC2 protein functional? What analysis have do you as part of the protein characterization? 11/13/2023

The recombinant ARPC2 protein is a modified version of the natural ARPC2 protein, produced through genetic engineering techniques. ARPC2 is a subunit of the ARP2/3 protein complex, which plays a critical role in regulating actin cytoskeletal dynamics. The recombinant ARPC2 protein is typically designed for research purposes and is often used as a tool to study the function and interactions of the ARP2/3 complex. It is generated by introducing the genetic sequence of ARPC2 into a suitable expression system, such as bacteria, yeast, or mammalian cells, that can produce large quantities of the protein. The recombinant ARPC2 protein possesses similar structural and functional characteristics as the native ARPC2 protein. It typically retains the ability to interact with other subunits of the ARP2/3 complex and facilitates the formation of branched actin networks. This essential property allows researchers to investigate the mechanisms underlying actin polymerization and cytoskeletal remodeling in various biological processes. Moreover, the recombinant ARPC2 protein can be tagged with specific markers, such as fluorescent tags or affinity tags, to enable easy detection, purification, and visualization. This versatility enhances the utility of the protein in experimental studies. Overall, the recombinant ARPC2 protein serves as a valuable tool for understanding the cellular processes governed by the ARP2/3 complex and provides insights into its involvement in various physiological and pathological conditions. Our routine QC of ARPC2 protein includes BCA, SDS-PAGE, Western Blot, and Endotoxin detection. Here below are the optional services, case to case. Activity Test; HPLC; SEC; Protein Biotinylation; Protein labeling/conjugation.

Ask a Question for All ARPC2 Products

Required fields are marked with *

My Review for All ARPC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon