Recombinant Human ASIP protein, GST-tagged
Cat.No. : | ASIP-907H |
Product Overview : | Human ASIP partial ORF ( NP_001663.2, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASIP agouti signaling protein [ Homo sapiens (human) ] |
Official Symbol | ASIP |
Synonyms | ASIP; agouti signaling protein; ASP; AGSW; AGTI; AGTIL; SHEP9; agouti-signaling protein; agouti signaling protein, nonagouti homolog; agouti switch protein; nonagouti homolog |
Gene ID | 434 |
mRNA Refseq | NM_001672 |
Protein Refseq | NP_001663 |
MIM | 600201 |
UniProt ID | P42127 |
◆ Recombinant Proteins | ||
ASIP-3828C | Recombinant Chicken ASIP | +Inquiry |
ASIP-1930B | Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged | +Inquiry |
ASIP-018H | Recombinant Human ASIP protein, His-GST-tagged | +Inquiry |
ASIP-6018H | Recombinant Human ASIP protein(23-132aa), His&Myc-tagged | +Inquiry |
ASIP-917HFL | Recombinant Full Length Human ASIP Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIP-8651HCL | Recombinant Human ASIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASIP Products
Required fields are marked with *
My Review for All ASIP Products
Required fields are marked with *