Recombinant Human BIRC7 Protein, GST-tagged
Cat.No. : | BIRC7-231H |
Product Overview : | Human BIRC7 full-length ORF ( NP_647478.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 59.2 kDa |
AA Sequence : | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIRC7 baculoviral IAP repeat containing 7 [ Homo sapiens ] |
Official Symbol | BIRC7 |
Synonyms | BIRC7; baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing protein 7; KIAP; kidney inhibitor of apoptosis protein; livin; livin inhibitor of apoptosis; melanoma inhibitor of apoptosis protein; ML IAP; mliap; RNF50; RING finger protein 50; LIVIN; MLIAP; ML-IAP; |
Gene ID | 79444 |
mRNA Refseq | NM_022161 |
Protein Refseq | NP_071444 |
MIM | 605737 |
UniProt ID | Q96CA5 |
◆ Recombinant Proteins | ||
BIRC7-229H | Active Recombinant Human BIRC7 protein(Met1-Ser298), His-tagged | +Inquiry |
BIRC7-232H | Recombinant Human BIRC7 Protein, GST-tagged | +Inquiry |
BIRC7-636H | Active Recombinant Human BIRC7 Protein, GST-tagged | +Inquiry |
BIRC7-0093H | Recombinant Human BIRC7 Protein (M1-S298), His tagged | +Inquiry |
BIRC7-3679H | Recombinant Human BIRC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC7-8447HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
BIRC7-8448HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC7 Products
Required fields are marked with *
My Review for All BIRC7 Products
Required fields are marked with *