Recombinant Human BIRC7 protein, His-tagged
| Cat.No. : | BIRC7-2569H |
| Product Overview : | Recombinant Human BIRC7 protein(151-240 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151-240 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAQAQRAWWVLEPPGARDVE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | BIRC7 baculoviral IAP repeat containing 7 [ Homo sapiens ] |
| Official Symbol | BIRC7 |
| Synonyms | BIRC7; baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing protein 7; KIAP; kidney inhibitor of apoptosis protein; livin; livin inhibitor of apoptosis; melanoma inhibitor of apoptosis protein; ML IAP; mliap; RNF50; RING finger protein 50; LIVIN; MLIAP; ML-IAP; |
| Gene ID | 79444 |
| mRNA Refseq | NM_022161 |
| Protein Refseq | NP_071444 |
| MIM | 605737 |
| UniProt ID | Q96CA5 |
| ◆ Recombinant Proteins | ||
| BIRC7-2176HFL | Recombinant Full Length Human BIRC7 Protein, C-Flag-tagged | +Inquiry |
| BIRC7-375H | Recombinant Human Baculoviral IAP Repeat-containing 7, His-tagged | +Inquiry |
| BIRC7-232H | Recombinant Human BIRC7 Protein, GST-tagged | +Inquiry |
| BIRC7-229H | Active Recombinant Human BIRC7 protein(Met1-Ser298), His-tagged | +Inquiry |
| BIRC7-231H | Recombinant Human BIRC7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BIRC7-8447HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
| BIRC7-8448HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BIRC7 Products
Required fields are marked with *
My Review for All BIRC7 Products
Required fields are marked with *
