Recombinant human BMP7, Active
Cat.No. : | BMP7-1548H |
Product Overview : | Recombinant human BMP 7 is a protein composed of 16.5 kDa single chain, containing 144 amino residues. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Description : | The bone morphogenetic proteins are a family of secreted signalling molecules that can induce ectopic bone growth. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extra skeletal site. Bone morphogenetic protein 7 (BMP7), also known as osteogenic protein 1 (OP1), is a widely expressed TGFb superfamily member with important functions during embryogenesis, in the adult, and in disease (Chen et al., 2004, Kishigami and Mishina 2005). BMP7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development (Sampath et al., 1992, Kazama et al., 2008), inhibits the branching of prostate epithelium (Grishina et al., 2005), and antagonizes epithelial-mesenchymal transition (EMT) (Zeisberg et al., 2003, Yu et al., 2009).In pathological conditions, BMP7 inhibits tumour growth and metastasis (Buijs et al., 2007), ameliorates fibrotic damage in nephritis (Zeisberg et al., 2003), and promotes neuroregeneration following brain ischemia (Chou et al., 2006). |
Form : | Recombinant human BMP 7 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4. |
Molecular Mass : | 16.5 kDa |
AA Sequence : | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEG ECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | BMP7 bone morphogenetic protein 7 [ Homo sapiens ] |
Official Symbol | BMP7 |
Synonyms | BMP7; bone morphogenetic protein 7; OP 1; osteogenic protein 1; BMP-7; OP-1; |
Gene ID | 655 |
mRNA Refseq | NM_001719 |
Protein Refseq | NP_001710 |
MIM | 112267 |
UniProt ID | P18075 |
Chromosome Location | 20q13 |
Pathway | ALK2 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog signaling pathway, organism-specific biosystem; Hedgehog signaling pathway, conserved biosystem; |
Function | cytokine activity; growth factor activity; protein binding; contributes_to protein binding; |
◆ Recombinant Proteins | ||
BMP7-163H | Active Recombinant Human BMP7 Protein, Biotinylated | +Inquiry |
BMP7-10H | Recombinant Human Bone Morphogenetic Protein 7, His-tagged | +Inquiry |
BMP7-134H | Active Recombinant Human BMP7, Animal Free | +Inquiry |
Bmp7-42M | Recombinant Mouse Bmp7 protein, His-tagged | +Inquiry |
BMP7-274H | Recombinant Human BMP7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB-1276RH | Rabbit Anti-Human BMP 7 Polyclonal Antibody | +Inquiry |
BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP7 Products
Required fields are marked with *
My Review for All BMP7 Products
Required fields are marked with *