Recombinant Human BTRC protein, GST-tagged

Cat.No. : BTRC-12H
Product Overview : Recombinant Human BTRC protein(308-605 aa), fused with GST tag, was expressed in E. coli,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 308-605 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name BTRC beta-transducin repeat containing E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol BTRC
Synonyms BTRC; beta-transducin repeat containing E3 ubiquitin protein ligase; beta transducin repeat containing; F-box/WD repeat-containing protein 1A; beta TrCP1; betaTrCP; bTrCP; bTrCP1; FBXW1A; Fwd1; beta-TrCP1; E3RSIkappaB; F-box and WD-repeat protein 1B; pIkappaBalpha-E3 receptor subunit; F-box and WD repeats protein beta-TrCP; FWD1; FBW1A; FBXW1; BETA-TRCP; MGC4643
Gene ID 8945
mRNA Refseq NM_001256856
Protein Refseq NP_001243785
MIM 603482
UniProt ID Q9Y297

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTRC Products

Required fields are marked with *

My Review for All BTRC Products

Required fields are marked with *

0
cart-icon